PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B04010.1.p
Common NameEUGRSUZ_B04010, LOC104434125
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 553aa    MW: 60279.9 Da    PI: 6.9934
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B04010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.7e-33202259260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Eucgr.B04010.1.p 202 DDGYNWRKYGQKQVKGSENPRSYYKCTHPTCPTKKKVERSL-DGQITEIVYKGSHNHPK 259
                       8****************************************.***************85 PP

2WRKY106.51.4e-33376434159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Cts+gCpv+k+ver+++d ++v++tYeg+Hnh+
  Eucgr.B04010.1.p 376 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSPGCPVRKHVERASHDLRAVITTYEGKHNHD 434
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-29190260IPR003657WRKY domain
SuperFamilySSF1182901.31E-25195260IPR003657WRKY domain
PROSITE profilePS5081123.789196260IPR003657WRKY domain
SMARTSM007744.0E-36201259IPR003657WRKY domain
PfamPF031062.2E-25202258IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-37361436IPR003657WRKY domain
SuperFamilySSF1182902.35E-29368436IPR003657WRKY domain
PROSITE profilePS5081138.721371436IPR003657WRKY domain
SMARTSM007742.5E-39376435IPR003657WRKY domain
PfamPF031067.8E-26377434IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MASPSAGTGS LDPRANSFSF SSLLASELED DSRRGSGVPK FKSIPPPSIP ISPLSSAFFA  60
IPPGLSPAEL LDSPVLLNAS NILPSPTTGA FPLQSSFNWK SKSSDSYQQI SKREDANGSD  120
FTLQTNAKQH LQQQQQQQQL AWSSIKQDGS RPPDESAVKS ELNPFQSFSP EIATIQTNAD  180
HRADCDNYQS QAQSMREQRR SDDGYNWRKY GQKQVKGSEN PRSYYKCTHP TCPTKKKVER  240
SLDGQITEIV YKGSHNHPKP QATRRSSASS SSSAPSHAVQ VYNPAAPEIN DHAFSTHGSS  300
QVDSATPENS SLSVADDEYD QGSQKSKSAG DEFDEDQPDP KRWKQEVENE GILAPGSRTV  360
REPRVVVQTT SDIDILDDGY RWRKYGQKVV KGNPNPRSYY KCTSPGCPVR KHVERASHDL  420
RAVITTYEGK HNHDVPAARG SGGANRPLPM PDNGNGNNGL ADSIRSSALT NHSNNNGPSA  480
PSSNYRVSSS EGQASPFMLE MLQSPGSFGF SGLGSSLGSF LNQSPNTDNL FSRAKEEPRD  540
DMFLESLLCR NY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-38190437678Probable WRKY transcription factor 4
2lex_A5e-38190437678Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1337344PDPKRWKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B04010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045395.10.0PREDICTED: probable WRKY transcription factor 26
RefseqXP_010045396.10.0PREDICTED: probable WRKY transcription factor 26
TrEMBLA0A059DA090.0A0A059DA09_EUCGR; Uncharacterized protein
STRINGVIT_06s0004g07500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-96WRKY DNA-binding protein 33